« Back
Home /
Kallikrein 3 Recombinant Protein

Kallikrein 3 Recombinant Protein

Item no.	PRS-91-336-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Breast Cancer Testicular & Prostate Cancer
Type	Proteins Recombinant
Format	Lyophilized
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Prostate-Specific Antigen, PSA, Gamma-Seminoprotein, Seminin, Kallikrein-3, P-30 Antigen, Semenogelase, KLK3, APS
Available
Applications	This recombinant protein can be used for biological assays. For research use only.
Applications	This recombinant protein can be used for biological assays. For research use only.
Buffer	Lyophilized from a 0.2 um filtered solution of 20mM MES, 150mM NaCl, 2mM CaCl2, pH 6.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
Storage Conditions	Lyophilized protein should be stored at -20˚ C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7˚ C for 2-7 days. Aliquots of reconstituted samples are stable at -20˚ C for 3 months.
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight	27.88 kD
Purity	Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background	Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many Kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen members of the Kallikrein subfamily located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein.
Accession #	P07288
Ncbi Gene Id #	354
Ncbi Official Symbol	KLK3
Ncbi Official Full Name	kallikrein related peptidase 3
Ncbi Organism	Homo sapiens
Swissprot #	P07288
Fusion Tag	C-6 His tag
Sequence	Ala18-Pro261
Peptide Sequence	APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANPVDHHHHHH

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 9/6/2024

Express Delivery: Save 21 days

Compare

Add to wishlist

Recommend by mail