Comparison

NM23-H1 Recombinant Protein

Item no. PRS-91-221-0.05mg
Manufacturer ProSci
Amount 0.05 mg
Category
Type Proteins Recombinant
Format Liquid
Specific against other
Dry ice Yes
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Nucleoside Diphosphate Kinase A, NDK A, NDP Kinase A, Granzyme A-Activated DNase, GAAD, Metastasis Inhibition Factor nm23, Tumor Metastatic Process-Associated Protein, nm23-H1, NME1, NDPKA, NM23
Available
Applications
This recombinant protein can be used for biological assays. For research use only.
Applications
This recombinant protein can be used for biological assays. For research use only.
Buffer
Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 1mM DTT, 10% Glycerol, pH 7.5. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Storage Conditions
Store at -20˚ C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight
19.3 kD
Purity
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background
Nucleoside-Diphosphate Kinases (NDKs) are enzymes that catalyze the exchange of phosphate groups between different nucleoside diphosphates. NDKs Possesse nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3-5 exonuclease activities. NDKs involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression and required for neural development including neural patterning and cell fate determination. Prokaryotic NDK forms a functional homotetramer.There are two isoforms of NDK in humans: NDK-A and NDK-B. Both have very similar structure, and can combine in any proportion to form functional NDK hexamers.
Accession #
P15531
Ncbi Gene Id #
4830
Ncbi Official Symbol
NME1
Ncbi Official Full Name
NME/NM23 nucleoside diphosphate kinase 1
Ncbi Organism
Homo sapiens
Swissprot #
P15531
Fusion Tag
N-6 His tag
Sequence
Met1-Glu152
Peptide Sequence
MGSSHHHHHHSSGLVPRGSHMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.05 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close