Item no. |
PRS-91-221-0.05mg |
Manufacturer |
ProSci
|
Amount |
0.05 mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid |
Specific against |
other |
Dry ice |
Yes
|
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Nucleoside Diphosphate Kinase A, NDK A, NDP Kinase A, Granzyme A-Activated DNase, GAAD, Metastasis Inhibition Factor nm23, Tumor Metastatic Process-Associated Protein, nm23-H1, NME1, NDPKA, NM23 |
Available |
|
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Buffer |
Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 1mM DTT, 10% Glycerol, pH 7.5. It is not recommended to reconstitute to a concentration less than 100 ug/ml. |
Storage Conditions |
Store at -20˚ C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Disclaimer |
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures. |
Predicted Molecular Weight |
19.3 kD |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Background |
Nucleoside-Diphosphate Kinases (NDKs) are enzymes that catalyze the exchange of phosphate groups between different nucleoside diphosphates. NDKs Possesse nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3-5 exonuclease activities. NDKs involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression and required for neural development including neural patterning and cell fate determination. Prokaryotic NDK forms a functional homotetramer.There are two isoforms of NDK in humans: NDK-A and NDK-B. Both have very similar structure, and can combine in any proportion to form functional NDK hexamers. |
Accession # |
P15531 |
Ncbi Gene Id # |
4830 |
Ncbi Official Symbol |
NME1 |
Ncbi Official Full Name |
NME/NM23 nucleoside diphosphate kinase 1 |
Ncbi Organism |
Homo sapiens |
Swissprot # |
P15531 |
Fusion Tag |
N-6 His tag |
Sequence |
Met1-Glu152 |
Peptide Sequence |
MGSSHHHHHHSSGLVPRGSHMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.