« Back
Home /
UBE2T Recombinant Protein

UBE2T Recombinant Protein

Item no.	PRS-91-167-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Autophagy Proliferation
Type	Proteins Recombinant
Format	Liquid
Specific against	other
Dry ice	Yes
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Ubiquitin-Conjugating Enzyme E2 T, Cell Proliferation-Inducing Gene 50 Protein, Ubiquitin Carrier Protein T, Ubiquitin-Protein Ligase T, UBE2T, HSPC150
Available
Applications	This recombinant protein can be used for biological assays. For research use only.
Applications	This recombinant protein can be used for biological assays. For research use only.
Buffer	Supplied as a 0.2 um filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Storage Conditions	Store at -20˚ C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Predicted Molecular Weight	24.7 kD
Purity	Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Background	Ubiquitin-Conjugating Enzyme E2 T (UBE2T) is a ligase that belongs to the Ubiquitin-Conjugating Enzyme family. UBE2T accepts the ATP-dependent ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, UBE2T is able to catalyze polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11'-, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination. UBE2T is an important factor of the Faconi anemia pathway of DNA damage repair and, upon self-inactivation, may negatively regulate the Faconi pathway.
Accession #	Q9NPD8
Ncbi Gene Id #	29089
Ncbi Official Symbol	UBE2T
Ncbi Official Full Name	ubiquitin conjugating enzyme E2 T
Ncbi Organism	Homo sapiens
Swissprot #	Q9NPD8
Fusion Tag	N-6 His tag
Sequence	Met1-Val197
Protein Gi#	78070603
Peptide Sequence	MGSSHHHHHHSSGLVPRGSHMQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 10/4/2024

Express Delivery: Save 7 days

Compare

Add to wishlist

Recommend by mail