Manufacturer |
ProSci
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Lyophilized |
Amount |
0.05 mg |
Item no. |
PRS-91-024-0.05mg |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Alias |
Interleukin-1 Receptor Antagonist Protein, IL-1RN, IL-1ra, IRAP, ICIL-1RA, IL1 Inhibitor, Anakinra, IL1RN, IL1F3, IL1RA, IL-1F3 |
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Applications |
This recombinant protein can be used for biological assays. For research use only. |
Buffer |
Lyophilized from a 0.2 um filtered solution of 50mM TrisHCl, 200mM NaCl, pH 7.5. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. |
Storage Conditions |
Lyophilized protein should be stored at -20˚ C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7˚ C for 2-7 days. Aliquots of reconstituted samples are stable at -20˚ C for 3 months. |
Disclaimer |
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures. |
Predicted Molecular Weight |
17.26 kD |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Background |
Interleukin-1 Receptor Antagonist (IL-1RN) is a member of the IL-1 family. Endogenous IL-1RN is produced in numerous animal disease models as well as in human autoimmune and chronic inflammatory diseases. It binds to IL-1 receptors in competition with IL-1, but does not elicit intracellular response from this binding. Its role in counteracting the proinflammatory effects of IL-1 is being studied by numerous research groups. IL-4 and IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble and intracellular forms of IL-1RN. The regulated expression of IL-1RN in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts, IL-1, TNF-alpha, or PDGF markedly enhances the synthesis of IL-1RN. |
Accession # |
P18510 |
Ncbi Gene Id # |
3557 |
Ncbi Official Symbol |
IL1RN |
Ncbi Official Full Name |
interleukin 1 receptor antagonist |
Ncbi Organism |
Homo sapiens |
Swissprot # |
P18510 |
Fusion Tag |
Tag Free |
Sequence |
Arg26-Glu177 |
Biological Activity |
ED50 is 0.5 ng/ml as determined by the dose-dependent inhibition of IL-1 stimulation of D10S cells. Specific Activity of 2.0 x 106 IU/mg. |
Protein Gi# |
325652083 |
Peptide Sequence |
MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.