Item no. |
NOVP-C750-1mg |
Manufacturer |
Novoprotein Scientific
|
Amount |
1 mg |
Quantity options |
10 ug
1 mg
500 ug
50 ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid |
Specific against |
E.coli |
Host |
E.coli |
Conjugate/Tag |
HIS |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Sequence |
MGSSHHHHHHSSGLVPRGSHMKVAVLGAAGGIGQA LALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIP TAVKIKGFSGEDATPALEGADVVLISAGVRRKPGM DRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNP VNTTVAIAAEVLKKAGVYDKNKLLGVTTLDIIRSN TFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQVP GVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATL SMG |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Malate dehydrogenase, mdh |
Available |
|
Background |
Escherichia coli MDH, also known as Malate dehydrogenase, is a group of multimeric enzymes consisting of identical subunits usually organized as either dimer or tetramers with subunit molecular weights of 30-35 kDa. Its major function is to catalyze the NAD / NADH-dependent interconversion of the substrates malate & oxaloacetate. This reaction plays a key part in the malate / aspartate shuttle across the mitochondrial membrane, & in the tricarboxylic acid cycle within the mitochondrial matrix.MDH is synthesized in several organisms including archaea, eubacteria, fungi, plant & mammals. The enzymes share a common catalytic mechanism & their kinetic properties are similar, which demonstrates a high degree of structural similarity. The three-dimensional structures & elements essential for catalysis are conserved between mitochondrial & cytoplasmic forms of MDH in eukaryotic cells even though these isoenzymes are only marginally related at the level of primary structure. |
Description |
Recombinant E.coli Malate Dehydrogenase is produced by our E.coli expression system & the target gene encoding Met1-Lys312 is expressed with a 6His tag at the N-terminus. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Formulation |
Supplied as a 0.2 um filtered solution of 50mM PB, 50%Glycerol, pH7.5. |
Molecular Weight |
34, 6 |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Seq Length |
Met1-Lys312 |
Ship Description |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.