« Back
Home /
Recombinant Human Tyrosinase(TYR),partial

Recombinant Human Tyrosinase(TYR),partial

Item no.	CSB-YP025394HU-20
Manufacturer	Cusabio
Amount	20ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Metabolism
Uniprot ID	P14679
Gene Names	TYR
Organism	Homo sapiens (Human)
AA Sequence	HFPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRG SCQNILLSNAPLGPQFPFTGVDDRESWPSVFYNRT CQCSGNFMGFNCGNCKFGFWGPNCTERRLLVRRNI FDLSAPEKDKFFAYLTLAKHTISSDYVIPIGTYGQ MKNGSTPMFNDINIYDLFVWMHYYVSMDALLGGSE IWRDIDFAHEAPAFLPWHRLFLLRWEQEIQKLTGD ENFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLL SPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLR RNPGNHDKSRTPRLPSSADVEFCLSLTQYESGSMD KAANFSFRNTLEGFASPLTGIADASQSSMHNALHI YMNGTMSQV
Expression Region	19-377aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	42.7 kDa
Alternative Name(s)	LB24-ABMonophenol monooxygenase; SK29-ABTumor rejection antigen AB
Relevance	This is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. Catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5, 6-dihydroxyindole to indole-5, 6 quinone.
Reference	Detection of 53 novel DNA variations within the tyrosinase gene and accumulation of mutations in 17 patients with albinism.Opitz S., Kaesmann-Kellner B., Kaufmann M., Schwinger E., Zuehlke C.Hum. Mutat. 23:630-631(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	This is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. Catalyzes the initial and rate limiting step in the cascade of reactions leading to melanin production from tyrosine. In addition to hydroxylating tyrosine to DOPA (3, 4-dihydroxyphenylalanine), also catalyzes the oxidation of DOPA to DOPA-quinone, and possibly the oxidation of DHI (5, 6-dihydroxyindole) to indole-5, 6 quinone.
Involvement in disease	Albinism, oculocutaneous, 1A (OCA1A); Albinism, oculocutaneous, 1B (OCA1B)
Subcellular Location	Melanosome membrane, Single-pass type I membrane protein, Melanosome
Protein Families	Tyrosinase family
Paythway	Melanogenesis
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time