« Back
Home /
Recombinant Human Elafin(PI3)

Recombinant Human Elafin(PI3)

Item no.	CSB-YP017952HU-20
Manufacturer	Cusabio
Amount	20ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Pancreatic Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Signal Transduction
Target / Protein	PI3
Biologically Active	Not Test
Expression System	Yeast
Species of origin	Homo sapiens (Human)
Uniprot ID	P19957
AA Sequence	AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKD TDCPGIKKCCEGSCGMACFVPQ
Tag Info	N-terminal 6xHis-tagged
Expression Region	61-117aa
Protein Length	Full Length of Mature Protein
MW	8.0 kDa
Alternative Name(s)	Elastase-specific inhibitor ; ESIPeptidase inhibitor 3 ; PI-3; Protease inhibitor WAP3Skin-derived antileukoproteinase ; SKALPWAP four-disulfide core domain protein 14
Relevance	Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.
Reference	Primary structure of the human elafin precursor preproelafin deduced from the nucleotide sequence of its gene and the presence of unique repetitive sequences in the prosegment.Saheki T., Ito F., Hagiwara H., Saito Y., Kuroki J., Tachibana S., Hirose S.Biochem. Biophys. Res. Commun. 185:240-245(1992)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.
Subcellular Location	Secreted
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time