Item no. |
CSB-YP013481RA-20 |
Manufacturer |
Cusabio
|
Amount |
20ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
Rat |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Areas |
Others |
Target / Protein |
Mapt |
Biologically Active |
Not Test |
Expression System |
Yeast |
Species of origin |
Rattus norvegicus (Rat) |
Uniprot ID |
P19332 |
AA Sequence |
AEPRQEFDTMEDQAGDYTMLQDQEGDMDHGLKESP PQPPADDGSEEPGSETSDAKSTPTAEDVTAPLVEE RAPDKQATAQSHTEIPEGTTAEEAGIGDTPNMEDQ AAGHVTQEPQKVEIFSQSLLVEPGRREGQAPDSGI SDWTHQQVPSMSGAPLPPQGLREATHQPLGTRPED VERSHPASELLWQESPQKEAWGKDRLGSEEEVDED ITMDESSQESPPSQASLAPGTATPQARSVSASGVS GETTSIPGFPAEGSIPLPADFFSKVSAETQASPPE GPGTGPSEEGHEAAPEFTFHVEIKASAPKEQDLEG ATVVGAPAEEQKARGPSVGKGTKEASLLEPTDKQP AAGLPGRPVSRVPQLKARVAGVSKDRTGNDEKKAK TSTPSCAKTPSNRPCLSPTRPTPGSSDPLIKPSSP AVCPEPATSPKYVSSVTPRNGSPGTKQMKLKGADG KTGAKIATPRGAATPGQKGTSNATRIPAKTTPSPK TPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSL PTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPM PDLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLS NVQSKCGSKDNIKHVPGGGSVHIVYKPVDLSKVTS KCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIG SLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGA EIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQL ATLADEVSASLAKQGL |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
2-752aa |
Protein Length |
Full Length of Mature Protein |
MW |
80.4 kDa |
Alternative Name(s) |
Neurofibrillary tangle protein; Paired helical filament-tau ; PHF-tau |
Relevance |
Promotes microtubule assbly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma mbrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization. |
Reference |
Cloning of a big tau microtubule-associated protein characteristic of the peripheral nervous system.Goedert M., Spillantini M.G., Crowther R.A.Proc. Natl. Acad. Sci. U.S.A. 89:1983-1987(1992) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization. |
Subcellular Location |
Cytoplasm, cytosol, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cytoskeleton, Cell projection, axon |
Tissue Specificity |
Expressed in neurons. The larger forms (isoform tau-A and isoform tau-B) are preferentially expressed in the peripheral nervous system while the other are expressed in the central nervous system. Low amounts of the larger forms are also found in limited areas of the CNS. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.