« Back
Home /
Recombinant Human Glypican-6(GPC6)

Recombinant Human Glypican-6(GPC6)

Item no.	CSB-YP009708HU-20
Manufacturer	Cusabio
Amount	20ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Signal Transduction
Uniprot ID	Q9Y625
Gene Names	GPC6
Organism	Homo sapiens (Human)
AA Sequence	DVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLR ICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHF VRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTY GMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLND FWARLLERMFQLINPQYHFSEDYLECVSKYTDQLK PFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVAN RVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNN YCLNVMKGCLANQADLDTEWNLFIDAMLLVAERLE GPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVF QGCGQPKPAPALRSARSAPENFNTRFRPYNPEERP TTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICK DESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQ INNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAY NGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFV TTEAPAVDPDRREVDS
Expression Region	24-529aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	59.6 kDa
Relevance	Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, Extracellular domain matrix proteins, proteases and anti-proteases . Enhances migration and invasion of cancer cells through WNT5A signaling.1 Publication
Reference	GPC6, a novel member of the glypican gene family, encodes a product structurally related to GPC4 and is colocalized with GPC5 on human chromosome 13.Paine-Saunders S., Viviano B.L., Saunders S.Genomics 57:455-458(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases (By similarity). Enhances migration and invasion of cancer cells through WNT5A signaling.
Involvement in disease	Omodysplasia 1 (OMOD1)
Subcellular Location	Cell membrane, Lipid-anchor, GPI-anchor, Extracellular side, SUBCELLULAR LOCATION: Secreted glypican-6: Secreted, extracellular space
Protein Families	Glypican family
Tissue Specificity	Widely expressed. High expression in fetal kidney and lung and lower expressions in fetal liver and brain. In adult tissues, very abundant in ovary, high levels also observed in liver, kidney, small intestine and colon. Not detected in peripheral blood leukocytes. Detected in breast cancer cells (at protein level).
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time