« Back
Home /
Recombinant Human Tumor necrosis factor receptor superfamily member 19L protein(RELT),partial

Recombinant Human Tumor necrosis factor receptor superfamily member 19L protein(RELT),partial

Item no.	CSB-RP081794h-20
Manufacturer	Cusabio
Amount	20ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Signal Transduction
Uniprot ID	Q969Z4
Gene Names	RELT
Organism	Homo sapiens (Human)
AA Sequence	STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAW GSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWP GWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARR GVEVAAGASSGGETRQPGNGTRA
Expression Region	26-153aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	17.7 kDa
Alternative Name(s)	Receptor expressed in lymphoid tissues
Relevance	Mediates activation of NF-kappa-B. May play a role in T-cell activation.
Reference	RELT, a new member of the tumor necrosis factor receptor superfamily, is selectively expressed in hematopoietic tissues and activates transcription factor NF-kappaB.Sica G.L., Zhu G., Tamada K., Liu D., Ni J., Chen L.Blood 97:2702-2707(2001)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Mediates activation of NF-kappa-B. May play a role in T-cell activation.
Subcellular Location	Cell membrane, Single-pass type I membrane protein, Cytoplasm
Protein Families	RELT family
Tissue Specificity	Highest levels are in spleen, lymph node, thymus, peripheral blood leukocytes, bone marrow and fetal liver. Very low levels in skeletal muscle, testis and colon. Not detected in brain, kidney and pancreas.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time