« Back
Home /
Recombinant Human Actin-related protein 2/3 complex subunit 3(ARPC3),partial

Recombinant Human Actin-related protein 2/3 complex subunit 3(ARPC3),partial

Item no.	CSB-RP033244h-20
Manufacturer	Cusabio
Amount	20ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Signal Transduction
Uniprot ID	O15145
Gene Names	ARPC3
Organism	Homo sapiens (Human)
AA Sequence	PAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRET KDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYI TLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIP GEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETG LRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSG
Expression Region	2-175aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	47.1 kDa
Alternative Name(s)	Arp2/3 complex 21KDA subunit ; p21-AR; C
Relevance	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.
Reference	Mammalian actin-related protein 2/3 complex localizes to regions of lamellipodial protrusion and is composed of evolutionarily conserved proteins.Machesky L.M., Reeves E., Wientjes F., Mattheyse F.J., Grogan A., Totty N.F., Burlingame A.L., Hsuan J.J., Segal A.W.Biochem. J. 328:105-112(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.
Subcellular Location	Cytoplasm, cytoskeleton, Cell projection
Protein Families	ARPC3 family
Paythway	Regulationofactincytoskeleton
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time