« Back
Home /
Recombinant Human Insulin growth factor-like family member 1(IGFL1) (Active)

Recombinant Human Insulin growth factor-like family member 1(IGFL1) (Active)

Item no.	CSB-MP764932HU-20ug
Manufacturer	Cusabio
Amount	20ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Lyophilized powder
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Gene Names	IGFL1
Expression Region	25-110aa
Sequence Info	Full Length of Mature Protein
Tag Info	C-terminal hFc-tagged
AASequence	APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
MW	38.7 kDa
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 (CSB-MP862025HU) at 2 μg/mL can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL.
Activity Image Link	https://www.cusabio.com/uploadfile/protein/1/CSB-MP764932HU-AC1.jpg
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance	Probable ligand of the IGFLR1 cell membrane receptor.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time