« Back
Home /
Recombinant Human Nucleolar protein 58(NOP58)

Recombinant Human Nucleolar protein 58(NOP58)

Item no.	CSB-EP896703HU-20
Manufacturer	Cusabio
Amount	20ug
Category	Oncology Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Metabolism
Uniprot ID	Q9Y2X3
Gene Names	NOP58
Organism	Homo sapiens (Human)
AA Sequence	MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETP EKANKIVKLKHFEKFQDTAEALAAFTALMEGKINK QLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLS CIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCL GLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKE LNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQK VGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTE VSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMM AIAPNVTVMVGELVGARLIAHAGSLLNLAKHAAST VQILGAEKALFRALKSRRDTPKYGLIYHASLVGQT SPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGV ENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYE HKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEIT EKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKR GKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKR ENED
Expression Region	1-529aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	75.6 kDa
Alternative Name(s)	Nucleolar protein 5
Relevance	Required for 60S ribosomal subunit biogenesis . Core component of box C/D small nucleolar ribonucleoprotein (snoRNP) particles. Required for the biogenesis of box C/D snoRNAs such as U3, U8 and U14 snoRNAs.3 Publications
Reference	Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. , Gu J., Chen S.-J., Chen Z.Genome Res. 10:1546-1560(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for 60S ribosomal subunit biogenesis (By similarity). Core component of box C/D small nucleolar ribonucleoprotein (snoRNP) particles. Required for the biogenesis of box C/D snoRNAs such as U3, U8 and U14 snoRNAs.
Subcellular Location	Nucleus, nucleolus, Nucleus, nucleoplasm
Protein Families	NOP5/NOP56 family
Tissue Specificity	Ubiquitous.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time