Item no. |
CSB-EP889918MO-1 |
Manufacturer |
Cusabio
|
Amount |
1mg |
Quantity options |
1mg
100ug
20ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Areas |
Metabolism |
Uniprot ID |
Q9R078 |
Gene Names |
Prkab1 |
Organism |
Mus musculus (Mouse) |
AA Sequence |
GNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKI LMDSPEDADIFHSEEIKAPEKEEFLAWQHDLEAND KAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLT RSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPI VTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDV SELSSSPPGPYHQEPYMSKPEERFKAPPILPPHLL QVILNKDTGISCDPALLPEPNHVMLNHLYALSIKD GVMVLSATHRYKKKYVTTLLYKPI |
Expression Region |
2-270aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
36.1 kDa |
Alternative Name(s) |
AMPK subunit beta-1 (AMPKb) |
Relevance |
Non-catalytic subunit of AMP-activated protein kinase, an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha and gamma subunits. |
Reference |
Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry. Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J. Mol. Cell. Proteomics 8:904-912(2009) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.