« Back
Home /
Recombinant Human Transmembrane prolyl 4-hydroxylase(P4HTM),partial

Recombinant Human Transmembrane prolyl 4-hydroxylase(P4HTM),partial

Item no.	CSB-EP878913HU-20
Manufacturer	Cusabio
Amount	20ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Cancer
Uniprot ID	Q9NXG6
Gene Names	P4HTM
Organism	Homo sapiens (Human)
AA Sequence	VHYSNGDESSDPGPQHRAQGPGPEPTLGPLTRLEG IKVGHERKVQLVTDRDHFIRTLSLKPLLFEIPGFL TDEECRLIIHLAQMKGLQRSQILPTEEYEEAMSTM QVSQLDLFRLLDQNRDGHLQLREVLAQTRLGNGWW MTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRD FHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMR AIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYH AHVDSGPVYPETICSHTKLVANESVPFETSCRQVS PNWGLPSILRPGTPMTQAQPCTVGVPLGMGPGDHW VIPVSPWEHPQLGTCSVPPLPYSYMTVLFYLNNVT GGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCD KGNLRVKPQQGTAVFWYNYLPDGQGWVGDVDDYSL HGGCLVTRGTKWIANNWINVDPSRARQALFQQEMA RLAREGGTDSQPEWALDRAYRDARVEL
Expression Region	82-563aa
Sequence Info	Partial of Isoform 3
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	70.5 kDa
Alternative Name(s)	Hypoxia-inducible factor prolyl hydroxylase 4 ; HIF-PH4 ; HIF-prolyl hydroxylase 4 ; HPH-4
Relevance	Catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates HIF1A at 'Pro-402' and 'Pro-564'. May function as a cellular oxygen sensor and, under normoxic conditions, may target HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex.
Reference	An endoplasmic reticulum transmembrane prolyl 4-hydroxylase is induced by hypoxia and acts on hypoxia-inducible factor alpha.Koivunen P., Tiainen P., Hyvaerinen J., Williams K.E., Sormunen R., Klaus S.J., Kivirikko K.I., Myllyharju J.J. Biol. Chem. 282:30544-30552(2007)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates HIF1A at 'Pro-402' and 'Pro-564'. May function as a cellular oxygen sensor and, under normoxic conditions, may target HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex.
Subcellular Location	Endoplasmic reticulum membrane, Single-pass type II membrane protein
Tissue Specificity	Widely expressed with highest levels in adult pancreas, heart, skeletal muscle, brain, placenta, kidney and adrenal gland. Expressed at lower levels in epiphyseal cartilage and in fibroblasts.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time