« Back
Home /
Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic(BAM1),partial

Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic(BAM1),partial

Item no.	CSB-EP878501DOA-20
Manufacturer	Cusabio
Amount	20ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Mouse
Conjugate/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Others
Target / Protein	BAM1
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Arabidopsis thaliana (Mouse-ear cress)
Uniprot ID	Q9LIR6
AA Sequence	AMNRNYKAHGTDPSPPMSPILGATRADLSVACKAF AVENGIGTIEEQRTYREGGIGGKKEGGGGVPVFVM MPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMI DVWWGLVEKESPGTYNWGGYNELLELAKKLGLKVQ AVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLA YTDQWGRRNHEYISLGADTLPVLKGRTPVQCYADF MRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSYP EQEGTWKFPGIGAFQCYDKYSLSSLKAAAETYGKP EWGSTGPTDAGHYNNWPEDTQFFKKEGGGWNSE
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	42-354aa
Protein Length	Partial
MW	41.7 kDa
Alternative Name(s)	1, 4-alpha-D-glucan maltohydrolase (Beta-amylase 7) (Thioredoxin-regulated beta-amylase) (TR-BAMY) (BMY7) (TRBAMY)
Relevance	Beta-amylase activity. Can use p-nitrophenyl maltopentaoside as substrate only in reduced form. Can play a minor role in the starch degradation and maltose metabolism in chloroplasts during the night. More active on phosphorylated glucan. Interacts directly with starch or other alpha-1, 4-glucan.
Reference	Empirical analysis of transcriptional activity in the Arabidopsis genome. Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. Ecker J.R. Science 302:842-846(2003)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time