Item no. |
CSB-EP760708HU-20 |
Manufacturer |
Cusabio
|
Amount |
20ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Conjugate/Tag |
Myc |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Areas |
Signal Transduction |
Uniprot ID |
Q6HA08 |
Gene Names |
ASTL |
Organism |
Homo sapiens (Human) |
AA Sequence |
APLASSCAGACGTSFPDGLTPEGTQASGDKDIPAI NQGLILEETPESSFLIEGDIIRPSPFRLLSATSNK WPMGGSGVVEVPFLLSSKYDEPSRQVILEALAEFE RSTCIRFVTYQDQRDFISIIPMYGCFSSVGRSGGM QVVSLAPTCLQKGRGIVLHELMHVLGFWHEHTRAD RDRYIRVNWNEILPGFEINFIKSQSSNMLTPYDYS SVMHYGRLAFSRRGLPTITPLWAPSVHIGQRWNLS ASDITRVLKLYGCSPSGPRPRGRGSHAHSTGRSPA PASLSLQRLLEALSAESRSPDPSGSSAGGQPVPAG PGESPHGWESPALKKLSAEASARQPQTLASSPRSR PGAGAPGVAQEQSWLAGVSTKPTVPSSEAGIQPVP VQGSPALPGGCVPRNHFKGMSED |
Expression Region |
24-431aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
MW |
50.6 kDa |
Alternative Name(s) |
Oocyte astacin (Ovastacin) |
Relevance |
Oocyte-specific oolemmal receptor involved in sperm and egg adhesion and fertilization. Plays a role in the polyspermy inhibition. Probably acts as a protease for the post-fertilization cleavage of ZP2. Cleaves the sperm-binding ZP2 at the surface of the zona pellucida after fertilization and cortical granule exocytosis, rendering the zona pellucida unable to support further sperm binding |
Reference |
Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. Bailey S.D., Xie C., Do R., Montpetit A., Diaz R., Mohan V., Keavney B., Yusuf S., Gerstein H.C., Engert J.C., Anand S. Diabetes Care 33:2250-2253(2010) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Oocyte-specific oolemmal receptor involved in sperm and egg adhesion and fertilization. Plays a role in the polyspermy inhibition. Probably acts as a protease for the post-fertilization cleavage of ZP2. Cleaves the sperm-binding ZP2 at the surface of the zona pellucida after fertilization and cortical granule exocytosis, rendering the zona pellucida unable to support further sperm binding (By similarity). |
Subcellular Location |
Cytoplasm, Cell membrane, Cytoplasmic granule, Cytoplasmic vesicle, secretory vesicle |
Protein Families |
Peptidase M12A family |
Tissue Specificity |
Expressed in promyelocytic leukemia HL-60 cells, Burkitt's lymphoma Raji cells, and also in some ovarian carcinomas. Not detected in normal tissues. |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.