« Back
Home /
Recombinant Human Dynactin subunit 1(DCTN1),partial

Recombinant Human Dynactin subunit 1(DCTN1),partial

Item no.	CSB-EP619866HU-20
Manufacturer	Cusabio
Amount	20ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Cell Biology
Target / Protein	DCTN1
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	Q14203
AA Sequence	PSKEEEGLRAQVRDLEEKLETLRLKRAEDKAKLKE LEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKE AKEALEAKERYMEEMADTADAIEMATLDKEMAEER AESLQQEVEALKERVDELTTDLEILKAEIEEKGSD GAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQE HVKLQKLMEKKNQELEVVRQQRERLQEELSQAEST IDELKEQVDAALGAEEMVEMLTDRNLNLEEKVREL RETVGDLEAMNEMNDELQENARETELELREQLDMA GARVREAQKRVEAAQETVADYQQTIKKYRQLTAHL QDVNRELTNQQEASVERQQQ
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	213-547
Protein Length	Partial
MW	55.2 kDa
Alternative Name(s)	150 kDa dynein-associated polypeptide DAP-150
Relevance	Required for the cytoplasmic dynein-driven retrograde movement of vesicles and organelles along microtubules. Dynein-dynactin interaction is a key component of the mechanism of axonal transport of vesicles and organelles.
Reference	Human DCTN1: genomic structure and evaluation as a candidate for Alstrom syndrome.Collin G.B., Nishina P.M., Marshall J.D., Naggert J.K. Genomics 53:359-364(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a key role in dynein-mediated retrograde transport of vesicles and organelles along microtubules by recruiting and tethering dynein to microtubules. Binds to both dynein and microtubules providing a link between specific cargos, microtubules and dynein. Essential for targeting dynein to microtubule plus ends, recruiting dynein to membranous cargos and enhancing dynein processivity (the ability to move along a microtubule for a long distance without falling off the track). Can also act as a brake to slow the dynein motor during motility along the microtubule
Involvement in disease	Neuronopathy, distal hereditary motor, 7B (HMN7B); Amyotrophic lateral sclerosis (ALS); Perry syndrome (PERRYS)
Subcellular Location	Cytoplasm, Cytoplasm, cytoskeleton, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole, Cytoplasm, cytoskeleton, spindle, Nucleus envelope, Cytoplasm, cell cortex
Protein Families	Dynactin 150 kDa subunit family
Tissue Specificity	Brain.
Paythway	SecretedExtracellularVesicles
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time