« Back
Home /
Recombinant Mouse Vimentin(Vim)

Recombinant Mouse Vimentin(Vim)

Item no.	CSB-EP025857MO-20
Manufacturer	Cusabio
Amount	20ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Mouse
Conjugate/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Cancer
Target / Protein	Vim
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	P20152
AA Sequence	STRSVSSSSYRRMFGGSGTSSRPSSNRSYVTTSTR TYSLGSALRPSTSRSLYSSSPGGAYVTRSSAVRLR SSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVE LQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQ GKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERD NLAEDIMRLREKLQEEMLQREEAESTLQSFRQDVD NASLARLDLERKVESLQEEIAFLKKLHDEEIQELQ AQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAA KNLQEAEEWYKSKFADLSEAANRNNDALRQAKQES NEYRRQVQSLTCEVDALKGTNESLERQMREMEENF ALEAANYQDTIGRLQDEIQNMKEEMARHLREYQDL LNVKMALDIEIATYRKLLEGEESRISLPLPTFSSL NLRETNLESLPLVDTHSKRTLLIKTVETRDGQVIN ETSQHHDDLE
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	2-466aa
Protein Length	Full Length of Mature Protein
MW	61.0 kDa
Relevance	imentins are class-III intermediate filaments found in various non-epithelial cells, especially mesenchymal cells. Vimentin is attached to the nucleus, endoplasmic reticulum, and mitochondria, either laterally or terminally.Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2.
Reference	Domain- and sequence-specific phosphorylation of vimentin induces disassembly of the filament structure. Ando S., Tanabe K., Gonda Y., Sato C., Inagaki M. Biochemistry 28:2974-2979(1989)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time