Item no. |
CSB-EP014646HU-20 |
Manufacturer |
Cusabio
|
Amount |
20ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
Human |
Host |
E.coli |
Conjugate/Tag |
Myc |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Areas |
others |
Target / Protein |
O95822 |
Biologically Active |
Not Test |
Expression System |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
O95822 |
AA Sequence |
MDELLRRAVPPTPAYELREKTPAPAEGQCADFVSF YGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGV LHLRQQQREAAVLLQAEDRLRYALVPRYRGLFHHI SKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMN GVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISE AEAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEP LVVLHVALTGDISSNIQAIVKEHPPSETEEKNKIT AAIFYSISLTQQGLQGVELGTFLIKRVVKELQREF PHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNEL FTDSECKEISEITGGPINETLKLLLSSSEWVQSEK LVRALQTPLMRLCAWYLYGEKHRGYALNPVANFHL QNGAVLWRINWMADVSLRGITGSCGLMANYRYFLE ETGPNSTSYLGSKIIKASEQVLSLVAQFQKNSKL |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Expression Region |
40-493AA |
Protein Length |
Full Length of Mature Protein |
MW |
55.9 kDa |
Relevance |
Catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acids with multiple methyl side chains are produced. In peroxisomes it may be involved in degrading intraperoxisomal malonyl-CoA, which is generated by the peroxisomal beta-oxidation of odd chain-length dicarboxylic fatty acids. Plays a role in the metabolic balance between glucose and lipid oxidation in muscle independent of alterations in insulin signaling. May play a role in controlling the extent of ischemic injury by promoting glucose oxidation. |
Reference |
MCD encodes peroxisomal and cytoplasmic forms of malonyl-CoA decarboxylase and is mutated in malonyl-CoA decarboxylase deficiency. Sacksteder K.A., Morrell J.C., Wanders R.J.A., Matalon R., Gould S.J. J. Biol. Chem. 274:24461-24468(1999) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acids with multiple methyl side chains are produced. In peroxisomes it may be involved in degrading intraperoxisomal malonyl-CoA, which is generated by the peroxisomal beta-oxidation of odd chain-length dicarboxylic fatty acids. Plays a role in the metabolic balance between glucose and lipid oxidation in muscle independent of alterations in insulin signaling. May play a role in controlling the extent of ischemic injury by promoting glucose oxidation. |
Involvement in disease |
Malonyl-CoA decarboxylase deficiency (MLYCD deficiency) |
Subcellular Location |
Cytoplasm, Mitochondrion matrix, Peroxisome, Peroxisome matrix |
Tissue Specificity |
Expressed in fibroblasts and hepatoblastoma cells (at protein level). Expressed strongly in heart, liver, skeletal muscle, kidney and pancreas. Expressed in myotubes. Expressed weakly in brain, placenta, spleen, thymus, testis, ovary and small intestine. |
Paythway |
AMPKSignaling |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.