Comparison

Recombinant Sheep Interleukin-4(IL4)

Item no. CSB-EP011659SH-20
Manufacturer Cusabio
Amount 20ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Sheep
Host E.coli
Conjugate/Tag Myc
Purity Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Research Areas
Immunology
Target / Protein
IL4
Biologically Active
Not Test
Expression System
E.coli
Species of origin
Ovis aries (Sheep)
Uniprot ID
P30368
AA Sequence
HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAA PKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLD RNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMR EKYSKC
Tag Info
N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged
Expression Region
25-135aa
Protein Length
Full Length of Mature Protein
MW
29.6 kDa
Alternative Name(s)
B-cell stimulatory factor 1
Relevance
Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.
Reference
Cloning and sequencing an ovine interleukin-4-encoding cDNA.Seow H.F., Rothel J.S., Wood P.R.Gene 124:291-293(1993)
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.
Subcellular Location
Secreted
Protein Families
IL-4/IL-13 family
Tag Information
N-terminal 10XHis-B2M-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close