« Back
Home /
Recombinant Human N(G),N(G)-dimethylarginine dimethylaminohydrolase 1(DDAH1)

Recombinant Human N(G),N(G)-dimethylarginine dimethylaminohydrolase 1(DDAH1)

Item no.	CSB-EP006579HU-200
Manufacturer	Cusabio
Amount	200ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human
Conjugate/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Cardiovascular
Target / Protein	DDAH1
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	O94760
AA Sequence	AGLGHPAAFGRATHAVVRALPESLGQHALRSAKGE EVDVARAERQHQLYVGVLGSKLGLQVVELPADESL PDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMK EALEKLQLNIVEMKDENATLDGGDVLFTGREFFVG LSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKS FCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDK LTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESA KVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINK KVDS
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	2-285aa
Protein Length	Full Length of Mature Protein
MW	38.4 kDa
Alternative Name(s)	DDAHI (Dimethylargininase-1) (DDAH-1) (Dimethylarginine dimethylaminohydrolase 1) (DDAH)
Relevance	Hydrolyzes N, N-dimethyl-L-arginine and N-monomethyl-L-arginine which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
Reference	Mechanism of 4-HNE mediated inhibition of hDDAH-1: implications in NO regulation. Forbes S.P., Druhan L.J., Guzman J.E., Parinandi N., Zhang L., Green-Church K.B., Cardounel A.J. Biochemistry 47:1819-1826(2008)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time