« Back
Home /
Recombinant Human Cadherin-1(CDH1),partial

Recombinant Human Cadherin-1(CDH1),partial

Item no.	CSB-EP005034HU-20
Manufacturer	Cusabio
Amount	20ug
Category	Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Signal Transduction
Target / Protein	CDH1
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P12830
AA Sequence	DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVF YSITGQGADTPPVGVFIIERETGWLKVTEPLDRER IATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNK PEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVN TYNAAIAYTILSQDPELPDKNMFTINRNTGVISVV TTGLDRESFPTYTLVVQAADLQGEGLSTTATAVIT VTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVT DADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDG ILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTS TATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQE ITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDT GAISTRAELDREDFEHVKNSTYTALIIATDNGSPV ATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKP QVINIIDADLPPNTSPFTAELTHGASANWTIQYND PTQESIILKPKMALEVGDYKINLKLMDNQNKDQVT TLEVSVCDCEGAAGVCRKAQPVEAGLQI
Tag Info	N-terminal 6xHis-tagged
Expression Region	155-707aa
Protein Length	Partial
MW	64.4 kDa
Alternative Name(s)	CAM 120/80Epithelial cadherin ; E-cadherinUvomorulin; CD324
Relevance	Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with thselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH1 is involved in mechanisms regulating cell-cell adhesions, mobility and proliferation of epithelial cells. Has a potent invasive suppressor role. It is a ligand for integrin alpha-E/beta-7.
Reference	Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cadherins are calcium-dependent cell adhesion proteins
Involvement in disease	Hereditary diffuse gastric cancer (HDGC); Endometrial cancer (ENDMC); Ovarian cancer (OC); Breast cancer, lobular (LBC); Blepharocheilodontic syndrome 1 (BCDS1)
Subcellular Location	Cell junction, Cell membrane, Single-pass type I membrane protein, Endosome, Golgi apparatus, trans-Golgi network
Tissue Specificity	Non-neural epithelial tissues.
Paythway	Hipposignalingpathway
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time