« Back
Home /
Recombinant Human Amino-terminal enhancer of split(AES)

Recombinant Human Amino-terminal enhancer of split(AES)

Item no.	CSB-EP001405HU-20
Manufacturer	Cusabio
Amount	20ug
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Stem Cells
Uniprot ID	Q08117
Gene Names	AES
Organism	Homo sapiens (Human)
AA Sequence	MCHKNGFPQEGGITAAFLQKRKLRLSKNHRPARAK VTEHVRGTRPGRATAGPAASTRAAGSLFFDRWGNR GPAGCRGSSHLPQQLKFTTSDSCDRIKDEFQLLQA QYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNI EMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAI ERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLT PLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKE DKNGHDGDTHQEDDGEKSD
Expression Region	1-264aa
Sequence Info	Full Length of Isoform 2
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	56.1 kDa
Alternative Name(s)	Gp130-associated protein GAM Grg-5 Groucho-related protein 5 Protein ESP1 Protein GRG
Relevance	Transcriptional corepressor. Acts as dominant repressor towards other family members. Inhibits NF-kappa-B-regulated gene expression. May be required for the initiation and maintenance of the differentiated state. Essential for the transcriptional repressor activity of SIX3 during retina and lens development.
Reference	Genomic organization and chromosome localization to band 19p13.3 of the human AES gene: gene product exhibits strong similarity to the N-terminal domain of Drosophila enhancer of split Groucho protein. Hou E.W., Li S.S.-L. DNA Cell Biol. 17:911-913(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transcriptional corepressor. Acts as dominant repressor towards other family members. Inhibits NF-kappa-B-regulated gene expression. May be required for the initiation and maintenance of the differentiated state. Essential for the transcriptional repressor activity of SIX3 during retina and lens development.
Subcellular Location	Nucleus
Protein Families	WD repeat Groucho/TLE family
Tissue Specificity	Found predominantly in muscle, heart and Placenta. In fetal tissues, abundantly expressed in the heart, lung, kidney, brain and liver.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time