« Back
Home /
Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), partial

Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), partial

Item no.	BM-RPC28511-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Protein Type	Recombinant Protein
Gene Name	TEAD4
Alternative Names	TEA domain family member 4; Short name:; TEAD-4; Transcription factor 13-like 1; Transcription factor RTEF-1
Uniprot	Q15561
Expression Region	74-434aa
AA Sequence	MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Sequence Info	Partial
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	44.5 kDa
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.14.
Endotoxin Level	Not Tested
Shipping Condition	Ice packs
Storage	Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Expiry Date	1 year
Research Area	Transcription
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 8/30/2024