« Back
Home /
Recombinant Human Protein mono-ADP-ribosyltransferase PARP14 (PARP14), partial

Recombinant Human Protein mono-ADP-ribosyltransferase PARP14 (PARP14), partial

Item no.	BM-RPC28365-20ug
Manufacturer	Biomatik
Amount	20ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Protein Type	Recombinant Protein
Gene Name	PARP14
Alternative Names	ADP-ribosyltransferase diphtheria toxin-like 8
Uniprot	Q460N5
Expression Region	1605-1801aa
AA Sequence	IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK
Sequence Info	Partial
Tag Info	C-terminal hFc-tagged
Theoretical MW	51.5 kDa
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not Tested
Shipping Condition	Ice packs
Storage	Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Expiry Date	1 year
Research Area	Primary antibodies
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	ADP-ribosyltransferase that mediates mono-ADP-ribosylation of glutamate residues on target proteins (PubMed:16061477, PubMed:27796300, PubMed:18851833, PubMed:25043379). In contrast to PARP1 and PARP2, it is not able to mediate poly-ADP-ribosylation (PubMed:25043379). Has been shown to catalyze the mono-ADP-ribosylation of STAT1 at 'Glu-657' and 'Glu-705', thus decreasing STAT1 phosphorylation which negatively regulates pro-inflammatory cytokine production in macrophages in response to IFNG stimulation (PubMed:27796300). However, the role of ADP-ribosylation in the prevention of STAT1 phosphorylation has been called into question and it has been suggested that the inhibition of phosphorylation may be the result of sumoylation of STAT1 'Lys-703' (PubMed:29858569). Mono-ADP-ribosylates STAT6; enhancing STAT6-dependent transcription (PubMed:27796300). In macrophages, positively regulates MRC1 expression in response to IL4 stimulation by promoting STAT6 phosphorylation (PubMed:27796300). Mono-ADP-ribosylates PARP9 (PubMed:27796300).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 14 days

Compare

Add to wishlist

Recommend by mail