Item no. |
BM-RPC27048-100ug |
Manufacturer |
Biomatik
|
Amount |
100ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Monocyte chemoattractant protein 1 receptor Short name:MCP-1-R CMKBR2 |
Similar products |
Monocyte chemoattractant protein 1 receptor Short name:MCP-1-R CMKBR2 |
Available |
|
Gene Name |
CCR2 |
Alternative Names |
Monocyte chemoattractant protein 1 receptor Short name:MCP-1-R CMKBR2 |
Uniprot |
P41597 |
Source |
in vitro E.coli expression system |
Expression Region |
1-374aa |
AA Sequence |
MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKF DVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINC KKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANE WVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYL AIVHAVFALKARTVTFGVVTSVITWLVAVFASVPG IIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILG LVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVI FTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCEST SQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSL FHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGL LDGRGKGKSIGRAPEASLQDKEGA |
Sequence Info |
Full Length |
Tag Info |
N-terminal 10xHis-tagged |
Theoretical MW |
45.4 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Measured by its binding ability in a functional ELISA. Immobilized CCR2 at 1 ug/ml can bind human CCL2, the EC50 of human CCL2 protein is 41.51-83.15 ug/ml. |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Receptor for the CCL2, CCL7 and CCL13 chemokines. Receptor for the beta-defensin DEFB106A/DEFB106B. Transduces a signal by increasing intracellular calcium ion levels. Upon CCL2 ligation, mediates chemotaxis and migration induction through the activation of the PI3K cascade, the small G protein Rac and lamellipodium protrusion (Probable). |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.