« Back
Home /
Recombinant Rabbit Tumor necrosis factor (TNF), partial (Active)

Recombinant Rabbit Tumor necrosis factor (TNF), partial (Active)

Item no.	BM-RPC26951-50ug
Manufacturer	Biomatik
Amount	50ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes By Cell Type Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis
Type	Proteins Recombinant
Specific against	Rabbit
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Tumor Necrosis Factor, Cachectin, TNF-Alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, TNF, TNFA, TNFSF2
Similar products	TNF, TNF-a, TNFA, TNFSF2, Cachectin, TNF-Alpha, Tumor Necrosis Factor, Tumor Necrosis Factor Ligand Superfamily Member 2
Available
Gene Name	TNF
Alternative Names	Tumor Necrosis Factor, Cachectin, TNF-Alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, TNF, TNFA, TNFSF2
Uniprot	P04924
Source	E.coli
Expression Region	77-235aa
AA Sequence	MVTLRSASRALSDKPLAHVVANPQVEGQLQWLSQR ANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQ GCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHR ETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQ PEYLDLAESGQVYFGIIAL
Sequence Info	Partial
Tag Info	Tag-Free
Theoretical MW	17.59 kDa
Purity	>95% as determined by SDS-PAGE.
Storage Buffer	Lyophilized from a 0.2 um filtered 20 mM PB, 300 mM NaCl, pH 7.4
Endotoxin Level	Less than 1.0 EU/ug as determined by LAL method.
Biological Activity	The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells is less than 20 pg/ml in the presence of the metabolic inhibitor actinomycin D.
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Tumor necrosis factor alpha (TNFalpha) is the prototypic ligand of the TNF superfamily. TNFalpha forms a homotrimer and functions by activating two types of receptors TNF-R1 (TNF receptor type 1, p55R) and TNF-R2 (TNF receptor type 2, p75R). TNFalpha is a pleiotropic cytokine that is capable to promote inflammation, to induce apoptotic cell death, and to inhibit tumorigenesis and viral replication. TNFalpha is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells and certain other target cells.
Function	Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; FUNCTION
Subcellular location	Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, membrane form: Membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, soluble form: Secreted, SUBCELLULAR LOCATION: C-domain 1: Secreted, SUBCELLULAR LOCATION: C-domain 2: Secreted
Protein Families	Tumor necrosis factor family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 11/1/2024

Express Delivery: Save 30 days

Compare

Add to wishlist

Recommend by mail