Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) (Active)

Tumor Necrosis Factor Receptor Superfamily Member 11B, Osteoclastogenesis Inhibitory Factor, Osteoprotegerin, TNFRSF11B, OCIF, OPG

Mammalian cell

ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTA KWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQ YVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPP GFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCR KHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCG IDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTK VNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDI VKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMES LPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKN GDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRF LHSFTMYKLYQKLFLEMIGNQVQSVKISCL

C-terminal 6xHis-tagged

>95% as determined by SDS-PAGE.

Less than 1.0 EU/ug as determined by LAL method.

Ice packs

1 year

TNFRSF11B is a secreted protein, containing 2 death domains and 4 TNFR-Cys repeats. TNFRSF11B is a decoy receptor for the receptor activator of nuclear factor kappa B ligand (RANKL). By binding RANKL, TNFRSF11B inhibits nuclear kappa B (NF-kappaB) which is a central and rapid acting transcription factor for immune-related genes, and a key regulator of inflammation, innate immunity, and cell survival and differentiation. TNFRSF11B levels are influenced by voltage-dependent calcium channelsCav1.2. TNFRSF11B can reduce the production of osteoclasts by inhibiting the differentiation of osteoclast precursors (osteoclasts are related to monocytes/macrophages and are derived from granulocyte/macrophage-forming colony units (CFU-GM)) into osteoclasts and also regulates the resorption of osteoclasts in vitroand in vivo. TNFRSF11B binding to RANKL on osteoblast/stromal cells, blocks the RANKL-RANK ligand interaction between osteoblast/stromal cells and osteoclast precursors. This has the effect of inhibiting the differentiation of the osteoclast precursor into a mature osteoclast.

Paget disease of bone 5, juvenile-onset (PDB5)

Highly expressed in adult lung, heart, kidney, liver, spleen, thymus, prostate, ovary, small intestine, thyroid, lymph node, trachea, adrenal gland, testis, and bone marrow. Detected at very low levels in brain, placenta and skeletal muscle. Highly expressed in fetal kidney, liver and lung.