« Back
Home /
Recombinant Human Platelet basic protein (PPBP), partial (Active)

Recombinant Human Platelet basic protein (PPBP), partial (Active)

Item no.	BM-RPC26797-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Platelet Basic Protein, PBP, C-X-C Motif Chemokine 7, Leukocyte-Derived Growth Factor, LDGF, Macrophage-Derived Growth Factor, MDGFSmall-Inducible Cytokine B7, PPBP, CTAP3, CXCL7, SCYB7, TGB1, THBGB1
Similar products	PPBP, PBP, CTAP3, CXCL7, LDGF, SCYB7, TGB1, THBGB1, Platelet Basic Protein, C-X-C Motif Chemokine 7, Leukocyte-Derived Growth Factor, Macrophage-Derived Growth Factor, MDGFSmall-Inducible Cytokine B7
Available
Gene Name	PPBP
Alternative Names	Platelet Basic Protein, PBP, C-X-C Motif Chemokine 7, Leukocyte-Derived Growth Factor, LDGF, Macrophage-Derived Growth Factor, MDGFSmall-Inducible Cytokine B7, PPBP, CTAP3, CXCL7, SCYB7, TGB1, THBGB1
Uniprot	P02775
Source	E.coli
Expression Region	59-128aa
AA Sequence	AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVE VIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Sequence Info	Partial
Tag Info	Tag-Free
Theoretical MW	7.6 kDa
Purity	>95% as determined by SDS-PAGE.
Storage Buffer	Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level	Less than 1.0 EU/ug as determined by LAL method.
Biological Activity	The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is typically 18 ng/mL.
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Human Chemokine (C-X-C motif) Ligand 7 (CXCL7), also known as neutrophil activating peptide 2 (NAP-2), is a member of the CXC chemokines containing an ELR domain (Glu-Leu-Arg tripeptide motif). Similar to other ELR domain containing CXC chemokines, such as IL-8 and the GRO proteins, CXCL7 binds CXCR2, chemoattracts and activates neutrophils. CXCL7, Connective Tissue Activating Protein III (CTAPIII) and betathrombogulin (betaTG), are proteolytically processed carboxylterminal fragments of platelet basic protein (PBP) which is found in the alphagranules of human platelets. Although CTAPIII, betaTG, and PBP represent amino-terminal extended variants of NAP2 and possess the same CXC chemokine domains, these proteins do not exhibit CXCL7/NAP2 activity. CXCL7 induces cell migration through the G-protein-linked receptor CXCR-2.
Function	LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
Subcellular location	Secreted
Protein Families	Intercrine alpha (chemokine CxC) family
Paythway	Chemokinesignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 8/30/2024