« Back
Home /
Recombinant Mouse Tenascin (Tnc), partial

Recombinant Mouse Tenascin (Tnc), partial

Item no.	BM-RPC26408-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Neuroscience Metabolism Diabetes Regulation of Appetite Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Necrosis
Type	Proteins Recombinant
Specific against	Mouse
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Hexabrachion Tenascin-C Short name: TN-C Hxb
Similar products	Hexabrachion Tenascin-C Short name: TN-C Hxb
Available
Gene Name	Tnc
Alternative Names	Hexabrachion Tenascin-C Short name: TN-C Hxb
Uniprot	Q80YX1
Source	Mammalian cell
Expression Region	1884-2099aa
AA Sequence	GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQA LEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYA AGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDH GESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSM NYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNC HRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEM KLRPSN
Sequence Info	Partial
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	28.8 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8:ITGB1, ITGA9:ITGB1, ITGAV:ITGB3 and ITGAV:ITGB6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells
Function	Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8
Subcellular location	Secreted, extracellular space, extracellular matrix
Protein Families	Tenascin family
Tissue Specificity	Expressed in kidney, aortic valve, corneal limbus, periosteum around the ribs, cerebellum, stomach and intestine (PubMed:14709716). High levels of isoform 2 in lung and brain of newborn mice. High levels of isoform 5 in thymus, moderate levels in brain of newborn and adult mice. Low level of isoform 2 in adult brain.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 12/27/2024

Express Delivery: Save 8 days

Compare

Add to wishlist

Recommend by mail