« Back
Home /
Recombinant Human Mucosal addressin cell adhesion molecule 1 (MADCAM1), partial

Recombinant Human Mucosal addressin cell adhesion molecule 1 (MADCAM1), partial

Item no.	BM-RPC26406-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion
Type	Proteins Recombinant
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name: MAdCAM-1 Short name: hMAdCAM-1
Similar products	Short name: MAdCAM-1 Short name: hMAdCAM-1
Available
Gene Name	MADCAM1
Alternative Names	Short name: MAdCAM-1 Short name: hMAdCAM-1
Uniprot	Q13477
Source	Mammalian cell
Expression Region	19-317aa
AA Sequence	QSLQVKPLQVEPPEPVVAVALGASRQLTCRLACAD RGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSA AGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPA ALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQEL EGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPP LGTPVPPALYCQATMRLPGLELSHRQAIPVLHSPT SPEPPDTTSPESPDTTSPESPDTTSQEPPDTTSPE PPDKTSPEPAPQQGSTHTPRSPGSTRTRRPEISQA GPTQGEVIPTGSSKPAGDQ
Sequence Info	Extracellular Domain
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	34.9 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
Function	Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
Subcellular location	Membrane, Single-pass type I membrane protein
Tissue Specificity	Highly expressed on high endothelial venules (HEV) and lamina propia venules found in the small intestine, and to a lesser extent in the colon and spleen. Very low levels of expression found in pancreas and brain. Not expressed in the thymus, prostate, ovaries, testis, heart, placenta, lung, liver, skeletal muscle, kidney or peripheral blood leukocytes.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 12/27/2024

Express Delivery: Save 8 days

Compare

Add to wishlist

Recommend by mail