« Back
Home /
Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3)

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3)

Item no.	BM-RPC26327-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Glucose Homeostasis Neural Signaling By Cell Type Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis Cell Stainings ECM
Type	Proteins Recombinant
Specific against	Mouse
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3
Similar products	Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3
Available
Gene Name	C1qtnf3
Alternative Names	Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3
Uniprot	Q9ES30
Source	Baculovirus
Expression Region	23-246aa
AA Sequence	QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPG PPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDL GPRGERGQHGPKGEKGYPGVPPELQIAFMASLATH FSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGV YFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYET KGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQ RFSTFAGFLLFETK
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	26.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Subcellular location	Secreted

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 8/30/2024

Express Delivery: Save 16 days

Compare

Add to wishlist

Recommend by mail