« Back
Home /
Recombinant Apis mellifera Phospholipase A2

Recombinant Apis mellifera Phospholipase A2

Item no.	BM-RPC26305-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Cardiovascular Research Thrombosis & Hemostasis Enzymes Fatty Acid Catabolism
Type	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Allergen Api m I (Phosphatidylcholine 2-acylhydrolase) (Allergen: Api m 1) (bvPLA2)
Similar products	Allergen Api m I (Phosphatidylcholine 2-acylhydrolase) (Allergen: Api m 1) (bvPLA2)
Available
Gene Name	N/A
Alternative Names	Allergen Api m I (Phosphatidylcholine 2-acylhydrolase) (Allergen: Api m 1) (bvPLA2)
Uniprot	P00630
Source	E.coli
Expression Region	34-167aa
AA Sequence	IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHD MCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDC LKNSADTISSYFVGKMYFNLIDTKCYKLEHPVTGC GERTEGRCLHYTVDKSKPKVYQWFDLRKY
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	19.3 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 4/24/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail