« Back
Home /
Recombinant Mouse Insulin-2 (Ins2)

Recombinant Mouse Insulin-2 (Ins2)

Item no.	BM-RPC26242-50ug
Manufacturer	Biomatik
Amount	50ug
Category	Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins Endocrine Regulation of Lipid Metabolism
Type	Proteins Recombinant
Specific against	Mouse
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Ins-2
Similar products	Ins-2
Available
Gene Name	Ins2
Alternative Names	Ins-2
Uniprot	P01326
Source	E.coli
Expression Region	25-110aa
AA Sequence	FVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVE DPQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQ CCTSICSLYQLENYCN
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	16.9 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 17 days

Compare

Add to wishlist

Recommend by mail