« Back
Home /
Recombinant Mouse cGMP-specific 3,5-cyclic phosphodiesterase (Pde5a), partial

Recombinant Mouse cGMP-specific 3,5-cyclic phosphodiesterase (Pde5a), partial

Item no.	BM-RPC26238-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins Cardiovascular Research Thrombosis & Hemostasis
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	cGMP-binding cGMP-specific phosphodiesterase (CGB-PDE) (Pde5)
Similar products	cGMP-binding cGMP-specific phosphodiesterase (CGB-PDE) (Pde5)
Available
Gene Name	Pde5a
Alternative Names	cGMP-binding cGMP-specific phosphodiesterase (CGB-PDE) (Pde5)
Uniprot	Q8CG03
Source	E.coli
Expression Region	154-320aa
AA Sequence	DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDK FLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHV AAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILC MPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDF AAYLAFCGIVLHNAQLYETSLLENKRN
Sequence Info	Partial
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	26.1 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. Specifically regulates nitric-oxide-generated cGMP.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 4/24/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail