« Back
Home /
Recombinant Rat Complement C5 (C5)

Recombinant Rat Complement C5 (C5)

Item no.	BM-RPC26194-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Rat (Rattus norvegicus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Gene Name	C5
Uniprot	P08650
Source	E.coli
Expression Region	1-77aa
AA Sequence	DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYE TCEQRVARVTIGPHCIRAFNECCTIADKIRKESHH KGMLLGR
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	14.0 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 4/24/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail