Item no. |
BM-RPC26188-1mg |
Manufacturer |
Biomatik
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Mouse (Murine, Mus musculus) |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Moesin-ezrin-radixin-like protein (Neurofibromin-2) (Schwannomin) (Nf-2) |
Similar products |
Moesin-ezrin-radixin-like protein (Neurofibromin-2) (Schwannomin) (Nf-2) |
Available |
|
Gene Name |
Nf2 |
Alternative Names |
Moesin-ezrin-radixin-like protein (Neurofibromin-2) (Schwannomin) (Nf-2) |
Uniprot |
P46662 |
Source |
E.coli |
Expression Region |
1-320aa |
AA Sequence |
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEF NCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKD TVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENA EEELVQEITQHLFFLQVKKQILDEKVYCPPEASVL LASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVIN LYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKI AQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYD PENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKI DVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADS LEVQQ |
Sequence Info |
Partial |
Tag Info |
N-terminal 6xHis-Trx-tagged |
Theoretical MW |
55.9 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Probable regulator of the Hippo/SWH signaling pathway, a signaling pathway that plays a pivotal role in tumor suppression by restricting proliferation and promoting apoptosis. Along with WWC1 can synergistically induce the phosphorylation of LATS1 and LATS2 and can probably function in the regulation of the Hippo/SWH signaling pathway. May act as a membrane stabilizing protein. May inhibit PI3 kinase by binding to AGAP2 and impairing its stimulating activity. Suppresses cell proliferation and tumorigenesis by inhibiting the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex. Plays a role in lens development and is required for complete fiber cell terminal differentiation, maintenance of cell polarity and separation of the lens vesicle from the corneal epithelium. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.