« Back
Home /
Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial

Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial

Item no.	BM-RPC26121-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Gene Name	CHRNA1
Uniprot	P02710
Source	Yeast
Expression Region	25-234aa
AA Sequence	SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGL QLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPA DYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHM TKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQ NCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGE WVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
Sequence Info	Partial
Tag Info	N-terminal 6xHis-sumostar-tagged
Theoretical MW	37.9 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Function	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Subcellular location	Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families	Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 4/24/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail