« Back
Home /
Recombinant Mouse Interleukin-31 receptor subunit alpha (Il31ra), partial

Recombinant Mouse Interleukin-31 receptor subunit alpha (Il31ra), partial

Item no.	BM-RPC26015-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines Cardiovascular Research Atherosclerosis Glial Cell Markers
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GLM-R (mGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (Novel cytokine receptor 10) (NR10) (ZcytoR17) (Glmr)
Similar products	GLM-R (mGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (Novel cytokine receptor 10) (NR10) (ZcytoR17) (Glmr)
Available
Gene Name	Il31ra
Alternative Names	GLM-R (mGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (Novel cytokine receptor 10) (NR10) (ZcytoR17) (Glmr)
Uniprot	Q8K5B1
Source	E.coli
Expression Region	19-499aa
AA Sequence	VLPTKPENISCVFYFDRNLTCTWRPEKETNDTSYI VTLTYSYGKSNYSDNATEASYSFPRSCAMPPDICS VEVQAQNGDGKVKSDITYWHLISIAKTEPPIILSV NPICNRMFQIQWKPREKTRGFPLVCMLRFRTVNSS HWTEVNFENCKQVCNLTGLQAFTEYVLALRFRFND SRYWSKWSKEETRVTMEEVPHVLDLWRILEPADMN GDRKVRLLWKKARGAPVLEKTFGYHIQYFAENSTN LTEINNITTQQYELLLMSQAHSVSVTSFNSLGKSQ EAILRIPDVHEKTFQYIKSMKAYIAEPLLVVNWQS SIPAVDTWIVEWLPEAAMSKFPALSWESVSQVTNW TIEQDKLKPFTCYNISVYPVLGHRVGEPYSIQAYA KEGTPLKGPETRVENIGLRTATITWKEIPKSARNG FINNYTVFYQAEGGKELSKTVNSHALQCDLESLTR RTSYTVWVMASTRAGGTNGVRINFKT
Sequence Info	Extracellular Domain
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	59.2 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Associates with OSMR to form the interleukin-31 receptor which activates STAT3 and to a lower extent STAT1 and STAT5. May function in skin immunity. Mediates IL31-induced itch, probably in a manner dependent on cation channels TRPA1 and TRPV1. Positively regulates numbers and cycling status of immature subsets of myeloid progenitor cells in bone marrow in vivo and enhances myeloid progenitor cell survival in vitro.
Function	Associates with OSMR to form the interleukin-31 receptor which activates STAT3 and to a lower extent STAT1 and STAT5. May function in skin immunity
Subcellular location	Cell membrane, Single-pass type I membrane protein, Cell junction, synapse, presynaptic cell membrane, Cell projection, axon
Protein Families	Type I cytokine receptor family, Type 2 subfamily
Tissue Specificity	Expressed in a subset of dorsal root ganglia neurons (PubMed:16926070, PubMed:24373353, PubMed:25381841). Expressed in spinal cord and trigeminal ganglion (at protein level) (PubMed:25381841). Expressed in skin, testis, bone marrow and thymus (PubMed:15184896).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 4/24/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail