« Back
Home /
Recombinant Human Apoptosis regulator Bcl-2 (BCL2), partial

Recombinant Human Apoptosis regulator Bcl-2 (BCL2), partial

Item no.	BM-RPC25986-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Oncology By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Apoptosis Autophagy Cardiovascular Research Ischemia & Reperfusion Injury By Organ Colorectal Cancer Testicular & Prostate Cancer
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Gene Name	BCL2
Uniprot	P10415
Source	E.coli
Expression Region	2-211aa
AA Sequence	AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVG AAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSP LQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSR RYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG VNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALW MTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Sequence Info	Partial
Tag Info	C-terminal 10xHis-tagged
Theoretical MW	25.2 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release
Function	Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release
Involvement in disease	A chromosomal aberration involving BCL2 has been found in chronic lymphatic leukemia. Translocation t(14; 18)(q32; q21) with immunoglobulin gene regions. BCL2 mutations found in non-Hodgkin lymphomas carrying the chromosomal translocation could be attributed to the Ig somatic hypermutation mechanism resulting in nucleotide transitions.
Subcellular location	Mitochondrion outer membrane, Single-pass membrane protein, Nucleus membrane, Single-pass membrane protein, Endoplasmic reticulum membrane, Single-pass membrane protein
Protein Families	Bcl-2 family
Tissue Specificity	Expressed in a variety of tissues.
Paythway	Estrogensignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 4/24/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail