« Back
Home /
Recombinant Streptomyces globisporus Lysozyme M1 (acm)

Recombinant Streptomyces globisporus Lysozyme M1 (acm)

Item no.	BM-RPC25984-50ug
Manufacturer	Biomatik
Amount	50ug
Category	Neuroscience Molecular Targets for Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins Cardiovascular Research Hypertension
Type	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	1,4-beta-N-acetylmuramidase M1
Similar products	1, 4-beta-N-acetylmuramidase M1
Available
Gene Name	acm
Alternative Names	1, 4-beta-N-acetylmuramidase M1
Uniprot	P25310
Source	E.coli
Expression Region	78-294aa
AA Sequence	DTSGVQGIDVSHWQGSINWSSVKSAGMSFAYIKAT EGTNYKDDRFSANYTNAYNAGIIRGAYHFARPNAS SGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSG AMCYGLSTTQMRTWINDFHARYKARTTRDVVIYTT ASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSG FPTWTFWQYSATGRVGGVSGDVDRNKFNGSAARLL ALANNTA
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	30.6 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	This enzyme has both lysozyme (acetylmuramidase) and diacetylmuramidase activities.
Function	This enzyme has both lysozyme (acetylmuramidase) and diacetylmuramidase activities.
Subcellular location	Secreted, extracellular space
Protein Families	Glycosyl hydrolase 25 family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 14 days

Compare

Add to wishlist

Recommend by mail