Item no. |
BM-RPC25946-50ug |
Manufacturer |
Biomatik
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Class B basic helix-loop-helix protein 6 Short name: bHLHb6 Class E basic helix-loop-helix protein 21 Short name: bHLHe21 |
Similar products |
Class B basic helix-loop-helix protein 6 Short name: bHLHb6 Class E basic helix-loop-helix protein 21 Short name: bHLHe21 |
Available |
|
Gene Name |
OLIG1 |
Alternative Names |
Class B basic helix-loop-helix protein 6 Short name: bHLHb6 Class E basic helix-loop-helix protein 21 Short name: bHLHe21 |
Uniprot |
Q8TAK6 |
Source |
Yeast |
Expression Region |
17-105aa |
AA Sequence |
MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSS TSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGS GAHPGGSARPDAKEEQQQQ |
Sequence Info |
Partial |
Tag Info |
N-terminal 6xHis-tagged |
Theoretical MW |
11.1 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube |
Function |
Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube (By similarity). |
Subcellular location |
Nucleus |
Tissue Specificity |
Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.