« Back
Home /
Recombinant Human Terminal nucleotidyltransferase 4A (TENT4B)

Recombinant Human Terminal nucleotidyltransferase 4A (TENT4B)

Item no.	BM-RPC25909-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Oncology Neuroscience Neural Development By Cell Type Blastoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	PAP-associated domain-containing protein 5 Terminal uridylyltransferase 3 Short name: TUTase 3 Topoisomerase-related function protein 4-2 Short name: TRF4-2
Similar products	PAP-associated domain-containing protein 5 Terminal uridylyltransferase 3 Short name: TUTase 3 Topoisomerase-related function protein 4-2 Short name: TRF4-2
Available
Gene Name	TENT4B
Alternative Names	PAP-associated domain-containing protein 5 Terminal uridylyltransferase 3 Short name: TUTase 3 Topoisomerase-related function protein 4-2 Short name: TRF4-2
Uniprot	Q8NDF8
Source	E.coli
Expression Region	1-572aa
AA Sequence	MYRSGERLLGSHALPAEQRDFLPLETTNNNNNHHQ PGAWARRAGSSASSPPSASSSPHPSAAVPAADPAD SASGSSNKRKRDNKASGGRAAGGGRADGGGVVYSG TPWKRRNYNQGVVGLHEEISDFYEYMSPRPEEEKM RMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPT SDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVK VLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAAD LIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGG IGSYSLFLMAVSFLQLHPREDACIPNTNYGVLLIE FFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNML DGYRPSMLYIEDPLQPGNDVGRSSYGAMQVKQAFD YAYVVLSHAVSPIAKYYPNNETESILGRIIRVTDE VATYRDWISKQWGLKNRPEPSCNGPVSSSSATQSS SSDVDSDATPCKTPKQLLCRPSTGNRVGSQDVSLE SSQAVGKMQSTQTTNTSNSTNKSQHGSARLFRSSS KGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRK HKRDAPLSDLCR
Sequence Info	Full Length
Tag Info	N-terminal 6xHis-SUMO-tagged
Theoretical MW	79.3 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Catalytic subunit of a TRAMP-like complex which has a poly(A) RNA polymerase activity and is involved in a post-transcriptional quality control mechanism. Polyadenylation with short oligo(A) tails is required for the degradative activity of the exosome on several of its nuclear RNA substrates. Doesn't need a cofactor for polyadenylation activity (in vitro). Plays a role in replication-dependent histone mRNA degradation, probably through terminal uridylation of mature histone mRNAs. May play a role in sister chromatid cohesion.
Function	Catalytic subunit of a TRAMP-like complex which has a poly(A) RNA polymerase activity and is involved in a post-transcriptional quality control mechanism. Polyadenylation with short oligo(A) tails is required for the degradative activity of the exosome on several of its nuclear RNA substrates. Doesn't need a cofactor for polyadenylation activity (in vitro). Plays a role in replication-dependent histone mRNA degradation, probably through terminal uridylation of mature histone mRNAs. May play a role in sister chromatid cohesion.
Subcellular location	Nucleus, Nucleus, nucleolus, Cytoplasm
Protein Families	DNA polymerase type-B-like family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 12/27/2024

Express Delivery: Save 8 days

Compare

Add to wishlist

Recommend by mail