Item no. |
BM-RPC25885-50ug |
Manufacturer |
Biomatik
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Lanimostim |
Similar products |
Lanimostim |
Available |
|
Gene Name |
CSF1 |
Alternative Names |
Lanimostim |
Uniprot |
P09603 |
Source |
Yeast |
Expression Region |
33-554aa |
AA Sequence |
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITF EFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDN TPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRT FYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCN NSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSP HQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLH TVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGS PQPRPSVGAFNPGMEDILDSAMGTNWVPEEASGEA SEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSAS SPLPASAKGQQPADVTGTALPRVGPVRPTGQDWNH TPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPS TLSAQPQLSRSHSSGSVLPLGELEGRRSTRDRRSP AEPEGGPASEGAARPLPRFNSVPLTDTGHERQSEG SFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRR RSHQEPQRADSPLEQPEGSPLTQDDRQVELPV |
Sequence Info |
Full Length of Mature Protein |
Tag Info |
N-terminal 6xHis-tagged |
Theoretical MW |
58.9 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hatopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and fale fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of mbrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance. |
Function |
Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance. |
Involvement in disease |
Aberrant expression of CSF1 or CSF1R can promote cancer cell proliferation, invasion and formation of metastases. Overexpression of CSF1 or CSF1R is observed in a significant percentage of breast, ovarian, prostate, and endometrial cancers.; DISEASE: Note=Aberrant expression of CSF1 or CSF1R may play a role in inflammatory diseases, such as rheumatoid arthritis, glomerulonephritis, atherosclerosis, and allograft rejection. |
Subcellular location |
Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Processed macrophage colony-stimulating factor 1: Secreted, extracellular space |
Paythway |
MAPKsignalingpathway |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.