Recombinant Human Gap junction alpha-1 protein (GJA1), partial

Connexin-43 Short name: Cx43 Gap junction 43KDA heart protein

E.coli

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAY FNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYN KQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDF PDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRAS SRPRPDDLEI

N-terminal 6xHis-tagged

>90% as determined by SDS-PAGE.

Not tested

Ice packs

1 year

Gap junction protein that acts as a regulator of bladder capacity. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. May play a critical role in the physiology of hearing by participating in the recycling of potassium to the cochlear endolymph. Negative regulator of bladder functional capacity: acts by enhancing intercellular electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimuli and causing them to contract (By similarity). May play a role in cell growth inhibition through the regulation of NOV expression and localization. Plays an essential role in gap junction communication in the ventricles (By similarity).