« Back
Home /
Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial

Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial

Item no.	BM-RPC25869-50ug
Manufacturer	Biomatik
Amount	50ug
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Development By Cell Type Blastoma Carcinoma Hematology Lymphoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Proliferation Viability By Organ Lung Cancer Bladder Cancer Breast Cancer Testicular & Prostate Cancer Cytoskeleton Markers
Type	Proteins Recombinant
Specific against	Human
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Gene Name	MKI67
Uniprot	P46013
Source	E.coli
Expression Region	2962-3254aa
AA Sequence	VLRAPKVEPVGDVVSTRDPVKSQSKSNTSLPPLPF KRGGGKDGSVTGTKRLRCMPAPEEIVEELPASKKQ RVAPRARGKSSEPVVIMKRSLRTSAKRIEPAEELN SNDMKTNKEEHKLQDSVPENKGISLRSRRQNKTEA EQQITEVFVLAERIEINRNEKKPMKTSPEMDIQNP DDGARKPIPRDKVTENKRCLRSARQNESSQPKVAE ESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTK SQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVC VKKIRTRSHRDSE
Sequence Info	Partial
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	36.7 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Thought to be required for maintaining cell proliferation.
Function	Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly
Subcellular location	Chromosome, Nucleus, Nucleus, nucleolus

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 9/27/2024

Express Delivery: Save 16 days

Compare

Add to wishlist

Recommend by mail