« Back
Home /
Recombinant Mouse C-X-C motif chemokine 10 (Cxcl10)

Recombinant Mouse C-X-C motif chemokine 10 (Cxcl10)

Item no.	BM-RPC25861-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Type	Proteins Recombinant
Specific against	Mouse
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10
Similar products	10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10
Available
Gene Name	Cxcl10
Alternative Names	10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10
Uniprot	P17515
Source	E.coli
Expression Region	22-98aa
AA Sequence	IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLS CPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQ KRSKRAP
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal GST-tagged
Theoretical MW	35.7 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	In addition to its role as a proinflammatory cytokine, may participate in T-cell effector function and perhaps T-cell development.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 8/30/2024

Express Delivery: Save 16 days

Compare

Add to wishlist

Recommend by mail