« Back
Home /
Recombinant Mouse Secretoglobin family 1C member 1 (Scgb1c1)

Recombinant Mouse Secretoglobin family 1C member 1 (Scgb1c1)

Manufacturer	Biomatik
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse
Amount	100ug
Item no.	BM-RPC25796-100ug
eClass 6.1	34160400
eClass 9.0	42020190
Available
Alias	Secretoglobin RYD5 (Ryd5)
Gene Name	Scgb1c1
Alternative Names	Secretoglobin RYD5 (Ryd5)
Uniprot	Q7M742
Source	E.coli
Expression Region	24-95aa
AA Sequence	EDDNEFFMEFLQTLLVGTPEELYEGPLGKYNVNDM AKSALRELKSCIDELQPVHKEQLVKLLVQVLDAQE DT
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-SUMO-tagged
Theoretical MW	21.2 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Subcellular location	Secreted
Protein Families	Secretoglobin family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 8/30/2024

Express Delivery: Save 25 days

Compare

Add to wishlist

Recommend by mail