« Back
Home /
Recombinant Trypanosoma cruzi Heat shock protein 100 (HSP100)

Recombinant Trypanosoma cruzi Heat shock protein 100 (HSP100)

Manufacturer	Biomatik
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	50ug
Item no.	BM-RPC25787-50ug
eClass 6.1	34160400
eClass 9.0	42020190
Available
Alias	Protein CLP
Gene Name	HSP100
Alternative Names	Protein CLP
Uniprot	O15885
Source	E.coli
Expression Region	1-138aa
AA Sequence	NSPKGLEATREKVWQVVRSYFRPEFLNRLDDIVLF RRLGFGELHEIIDLIVAEVNGRLRSQDILLEVTDE AKNFVLENAFDAEMGARPLRRWVEKYITTEVSRMI LAQQLPPNSTVRVLVNGSQGKLAFSVKRSFVSE
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	22.9 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Protein Families	ClpA/ClpB family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 8/30/2024

Express Delivery: Save 28 days

Compare

Add to wishlist

Recommend by mail